PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG167300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 495aa    MW: 53765.7 Da    PI: 10.5907
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG167300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B330.65.9e-101622411499
                          T-EE--HHH.HTT.---..--SEEEEEETTS...-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  14 grlvlpkkfaeeh.ggkkeesktltledesg...rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          + l++p + ae +         + ++ ++sg   ++W+v++   + +g+ +l+ GW+eF+ a g  +g  +v++++g  ++ l++k+f++
  Pavir.7KG167300.1.p 162 DSLRIPDELAEGIcA------GEARVVSPSGgrvKVWRVEV--GRDGGGAFLGHGWSEFAAACGAGAGWLLVLRHHG--GGVLTFKAFDA 241
                          568899999966632......3689999999999*******..9******************************765..77789999986 PP

2B332.41.7e-104244822785
                          ---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3  27 ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          g+ +++++tl+   +s rsW+v+    k+s++yv +  Wk+F k+n++k+gD++++  +
  Pavir.7KG167300.1.p 424 GLREPCTITLKTSMSSTRSWQVRAVPYKNSSHYVGGLDWKRFSKENNIKVGDVCTINIV 482
                          66677776777666888*******8899999************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.247149242IPR003340B3 DNA binding domain
SMARTSM010190.002152242IPR003340B3 DNA binding domain
SuperFamilySSF1019361.2E-9159244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-10160244IPR015300DNA-binding pseudobarrel domain
PfamPF023627.7E-8160241IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-4259323IPR015300DNA-binding pseudobarrel domain
CDDcd100172.55E-9403479No hitNo description
SMARTSM010190.94405492IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-4407422IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-9423491IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.53E-9424490IPR015300DNA-binding pseudobarrel domain
PfamPF023629.5E-8425482IPR003340B3 DNA binding domain
PROSITE profilePS508639.573430494IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MLRPGDATAA AVFTVAFAIS LLETPGDGNR SAHHSGVPSE CRWVSARRPV LHCMARRTVA  60
RATRRSRQVQ RHGSSSRPEQ ALAGGAAAAS TCTMGVYAAV RGCSVRGGAP TEPPPAVLGL  120
AGKTRRGVCS ELRLPESRSK TKRAHVATNA KHLRVLLPFS CDSLRIPDEL AEGICAGEAR  180
VVSPSGGRVK VWRVEVGRDG GGAFLGHGWS EFAAACGAGA GWLLVLRHHG GGVLTFKAFD  240
ASGCMRDLGT PPAEATASSK DASRRPQFVS VLAQDFKEKM LIPAKFVQHH IPEEHLDNRM  300
AVVIGSLGKI SHVEIEINQS DMFFRDTGKQ QEAPYESIQN SKRKKDWPSR EGQKKPKGST  360
VSMNKASKRT AVYEIGPPSW IMKEINTSTL RKKLVNGIPC KNNSFVLVKG WMMFCRANSL  420
KEVGLREPCT ITLKTSMSST RSWQVRAVPY KNSSHYVGGL DWKRFSKENN IKVGDVCTIN  480
IVETTLWHVD VAHQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1341356KRKKDWPSREGQKKPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-117PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9VAH11e-117A0A0A9VAH1_ARUDO; Uncharacterized protein
STRINGSi012721m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187